PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 348aa    MW: 37679.1 Da    PI: 8.6799
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01386.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.4e-32182238158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++Il+RRq Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  KHN01386.1 182 EEPMYVNAKQYHAILRRRQYRAKLEAQNKL-IKERKPYLHESRHLHALKRARGSGGRF 238
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.7E-37180241IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.834181241IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-26183238IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-24184206IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860186206IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.7E-24215238IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MKNLCENGSG PTHLTSYALG CSSWGTSSES DVQQSSMSKS LSLKMSVLPQ QCHKTKPLSF  60
QYQDRDSSST QSTGQSYPEV GSAQSGQISV QCSNSSASST HNTTGGKSVE GVIGSTVGIQ  120
DCTFPPSQLC YNQSLAHTAF HFAEPCFSGL LAAPFVPQSN IHHAQLLGMT PARIPLPLDL  180
SEEPMYVNAK QYHAILRRRQ YRAKLEAQNK LIKERKPYLH ESRHLHALKR ARGSGGRFLN  240
AKKLQELKLT SANRGLDVSG CTQLNLSGNM SESKVQAVEN LNYRNGASTT TCSDVISTSN  300
SDDVFQQHES DFRLCGYPSH IGRNMQGYSA DIGGGGGGGN QHRLSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-23182243263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7755280.0FJ775528.1 Glycine max CCAAT-binding transcription factor family protein (NF-YA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235387.10.0CCAAT-binding transcription factor family protein
RefseqXP_006582865.10.0PREDICTED: CCAAT-binding transcription factor family protein isoform X1
RefseqXP_014632808.10.0PREDICTED: CCAAT-binding transcription factor family protein isoform X1
RefseqXP_006582864.10.0PREDICTED: CCAAT-binding transcription factor family protein isoform X1
RefseqXP_006582863.10.0PREDICTED: CCAAT-binding transcription factor family protein isoform X1
RefseqXP_006582862.10.0PREDICTED: CCAAT-binding transcription factor family protein isoform X1
TrEMBLA0A0B2NW620.0A0A0B2NW62_GLYSO; Nuclear transcription factor Y subunit A-3
TrEMBLE0WC410.0E0WC41_SOYBN; CCAAT-binding transcription factor family protein
STRINGGLYMA07G04050.50.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-62nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]